PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Sopen04g026500.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Solanoideae; Solaneae; Solanum; Lycopersicon
Family GRAS
Protein Properties Length: 563aa    MW: 63263 Da    PI: 4.7899
Description GRAS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Sopen04g026500.1genomespennView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GRAS445.24.4e-1361955633374
              GRAS   3 elLlecAeavssgdlelaqalLarlselaspdgdpmqRlaayfteALaarlarsvselykalppsetseknsseelaalklfsevsPilkfsh 95 
                       + L++cA a+++g+ e+a++++++l++++s +gdp++R aay++eALaar+a s+ +lykal+++e++   sse+l+a+++++ev+P+++f++
  Sopen04g026500.1 195 QMLFSCAAAIQDGHIEQASSMINELRQMVSIQGDPLERTAAYMVEALAARMATSGRGLYKALKCKEAT---SSERLSAMQVLFEVCPYFRFGF 284
                       79*****************************************************************9...9********************* PP

              GRAS  96 ltaNqaIleavegeervHiiDfdisqGlQWpaLlqaLasRpegppslRiTgvgspesg..skeeleetgerLakfAeelgvpfefnvlvakrl 186
                       ++aN aIlea++ e+rvHiiDfd++qG Q+ +Llq+L s p++pp++R+Tgv++pes+      l+ +g rLa++A+ l+++fef++ v++++
  Sopen04g026500.1 285 MAANGAILEAFKDEKRVHIIDFDVNQGSQYYTLLQTLGSMPGKPPHVRLTGVDDPESVqrAIGGLNVIGLRLAQLAKDLKISFEFQA-VSSNT 376
                       ********************************************************99777789***********************.7**** PP

              GRAS 187 edleleeLrvkpgEalaVnlvlqlhrlldesvsleserdevLklvkslsPkvvvvveqeadhnsesFlerflealeyysalfdsleaklpres 279
                       + +++ +L+++pgEa+ Vn+++qlh+++desvs+ ++rd++L++vksl+Pk+v+vveq++++n+++Fl+rf+e  +yy a+f+sl+a+l+r+s
  Sopen04g026500.1 377 ALVTPAMLNCRPGEAVLVNFAFQLHHMPDESVSTVNQRDQLLRMVKSLNPKLVTVVEQDMNTNTAPFLQRFAEVYNYYCAVFESLDATLSRDS 469
                       ********************************************************************************************* PP

              GRAS 280 eerikvErellgreivnvvacegaerrerhetlekWrerleeaGFkpvplsekaakqaklllrkvksdgyrveeesgslvlgWkdrpLvsvSa 372
                       +er++vEr++l+r+i n+vaceg er+er e ++kWr+r+++aGF+p p+s +++++++ l+++++++ y+ eee g+l++gW+d++L+++Sa
  Sopen04g026500.1 470 QERVNVERQCLARDIINIVACEGLERIERYEVAGKWRARMMMAGFTPSPISRNVYESIRNLIKQYSER-YKAEEEAGALYFGWEDKTLTVASA 561
                       ******************************************************************66.************************ PP

              GRAS 373 Wr 374
                       Wr
  Sopen04g026500.1 562 WR 563
                       *8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5098566.168167544IPR005202Transcription factor GRAS
PfamPF035141.5E-133195563IPR005202Transcription factor GRAS
Sequence ? help Back to Top
Protein Sequence    Length: 563 aa     Download sequence    Send to blast
MSLVRSLRSI GNGKLYFQNG HNDNSSLATS MYTKNAREIM YATESSSTDS YDPKYLLESP  60
SPSEELLNTS PTDVLGNPFH QRHSSSFHPS RDYNQVSYDS ADCVNQSPDS SEYNDGRVTM  120
KLQELERVLF DDNEIEGDDV FARGETMDID DEWFNQIRTE LLQESPKEST SADSNISSSS  180
SYKEISVSAP QTPKQMLFSC AAAIQDGHIE QASSMINELR QMVSIQGDPL ERTAAYMVEA  240
LAARMATSGR GLYKALKCKE ATSSERLSAM QVLFEVCPYF RFGFMAANGA ILEAFKDEKR  300
VHIIDFDVNQ GSQYYTLLQT LGSMPGKPPH VRLTGVDDPE SVQRAIGGLN VIGLRLAQLA  360
KDLKISFEFQ AVSSNTALVT PAMLNCRPGE AVLVNFAFQL HHMPDESVST VNQRDQLLRM  420
VKSLNPKLVT VVEQDMNTNT APFLQRFAEV YNYYCAVFES LDATLSRDSQ ERVNVERQCL  480
ARDIINIVAC EGLERIERYE VAGKWRARMM MAGFTPSPIS RNVYESIRNL IKQYSERYKA  540
EEEAGALYFG WEDKTLTVAS AWR
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5hyz_A8e-611955636375GRAS family transcription factor containing p
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankHG9754430.0HG975443.1 Solanum pennellii chromosome ch04, complete genome.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015073725.10.0PREDICTED: scarecrow-like protein 1
RefseqXP_015073726.10.0PREDICTED: scarecrow-like protein 1
RefseqXP_015073727.10.0PREDICTED: scarecrow-like protein 1
SwissprotQ9SDQ30.0SCL1_ARATH; Scarecrow-like protein 1
TrEMBLQ00LP30.0Q00LP3_SOLLC; GRAS6
STRINGSolyc04g064550.1.10.0(Solanum lycopersicum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA89672429
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G21450.10.0SCARECROW-like 1